✦ LIBER ✦

Total Synthesis in Solution and Conformational Analysis of the Peptaibol Cervinin and Selected Analogues.

✍ Scribed by Chiara Baldini; Massimo Bellanda; Cristina Peggion; Albert Legrand Djontu; Come Atagua; Stefano Mammi; Claudio Toniolo

Publisher: John Wiley and Sons
Year: 2007
Weight: 11 KB
Volume: 38
Category: Article
ISSN: 0931-7597
DOI: 10.1002/chin.200737186

No coin nor oath required. For personal study only.

📜 SIMILAR VOLUMES

ChemInform Abstract: The First Total Syn

ChemInform Abstract: The First Total Synthesis of the Peptaibol Hypomurocin A1 and Its Conformation Analysis: An Application of the “Azirine/Oxazolone Method”

✍ Nicolas Pradeille; Oliver Zerbe; Kerstin Mohle; Anthony Linden; Heinz Heimgartne 📂 Article 📅 2010 🏛 John Wiley and Sons ⚖ 15 KB 👁 1 views

## Abstract ChemInform is a weekly Abstracting Service, delivering concise information at a glance that was extracted from about 100 leading journals. To access a ChemInform Abstract of an article which was published elsewhere, please select a “Full Text” option. The original article is trackable v

Total Synthesis and Conformational Analy

Total Synthesis and Conformational Analysis of the Antifungal Agent (-)-PF1163B.

✍ Fodil Bouazza; Brigitte Renoux; Christian Bachmann; Jean-Pierre Gesson 📂 Article 📅 2004 🏛 John Wiley and Sons ⚖ 60 KB 👁 2 views

Solution conformations of peptides repre

Solution conformations of peptides representing the sequence of the toxin pardaxin and analogues in trifluoroethanol-water mixtures: Analysis of CD spectra

✍ Sathiah Thennarasu; Ramakrishnan Nagaraj 📂 Article 📅 1997 🏛 Wiley (John Wiley & Sons) 🌐 English ⚖ 186 KB 👁 1 views

The cytolytic activities and conformational properties of pardaxin (GFFALIPKIISSPLFKTLLSAVGSALSSSGEQE), a 33-residue linear peptide that exhibits unusual shark repellent and cytolytic activities, and its analogues have been examined in aqueous environment and trifluoroethanol (TFE) using CD spectros

Application of 1H NMR selective and bise

Application of 1H NMR selective and biselective relaxation times. III—conformational analysis of quinidine in solution

✍ Torei Sai; Narao Takao; Makiko Sugiura 📂 Article 📅 1992 🏛 John Wiley and Sons 🌐 English ⚖ 380 KB 👁 1 views

## Abstract A relaxation method was applied to quinidine (1) where cross‐relaxations (σ~ij~) were obtained by ^1^H selective and biselective __T__~1~ measurements and correlation times for molecular reorientation (τ~c~) were evaluated from the frequency dependence of the non‐selective __T__~1.~ The

Conformational analysis of a 12-membered

Conformational analysis of a 12-membered crown dithioether in the solid state and in solution

✍ Vyacheslav V. Samoshin; Emmanuil I. Troyansky; Dmitry V. Demchuk; Rustem F. Isma 📂 Article 📅 1998 🏛 John Wiley and Sons 🌐 English ⚖ 271 KB 👁 2 views

The solid-state molecular structure and the conformational behaviour in solution of the 12-membered crown dithioether 8-methyl-1,4-dioxa-7,10-dithiacyclododecane-5,12-dione were studied by x-ray crystallography, 1 H and 13 C NMR spectroscopy and molecular mechanics. The conformational rigidity of so

Conformational analysis of the tyrosine

Conformational analysis of the tyrosine dipeptide analogue in the gas phase and in aqueous solution by a density functional/continuum solvent model

✍ Emma Langella; Nadia Rega; Roberto Improta; Orlando Crescenzi; Vincenzo Barone 📂 Article 📅 2002 🏛 John Wiley and Sons 🌐 English ⚖ 173 KB 👁 1 views

## Abstract The conformational behavior of a dipeptide analogue of tyrosine (TDA) has been investigated by density functional methods using the polarizable continuum model (PCM) for the description of solvent effects. Our study points out the interplay of backbone and side chain contributions in de