✦ LIBER ✦

Isolation and identification of a cAMP generating peptide from the flesh fly, Neobellieria bullata (Diptera: Sarcophagidae)

✍ Scribed by Kurt Spittaels; Bart Devreese; Liliane Schoofs; Hedwig Neven; Ine Janssen; Luc Grauwels; Jozef Van Beeumen; Arnold De Loof

Publisher: John Wiley and Sons
Year: 1996
Tongue: English
Weight: 818 KB
Volume: 31
Category: Article
ISSN: 0739-4462
DOI: 10.1002/(sici)1520-6327(1996)31:2<135::aid-arch2>3.0.co;2-z

No coin nor oath required. For personal study only.

✦ Synopsis

The Manduca sexta Malpighian tubule assay system, developed to monitor adenylate cyclase activity, was used i n combination with HPLC to isolate a novel cAMP generating peptide from 350,000 whole flesh flies, Neobelfieria bullata. Mass spectrometry revealed a molecular mass of 5,047 daltons, and Edman degradation the following sequence: AGAEAEKLSGLSKYFNGTTMAGRA-NVAKATYAVIGLIIAYNVMKPKKK. This 48-mer peptide, called Neb-cGP, does not belong to the corticotropin releasing factor family of insect diuretic peptides. Electrophoresis and subsequent immunoblotting of peptides immunoprecipitated from a homogenate of entire flies showed that one fly contained approximately 0.003 to 0.03 p g Neb-cGP and that 10 pg represents the lowest imrnunostainable amount on a Western blot.

📜 SIMILAR VOLUMES

Disruption of pupariation and eclosion b

Disruption of pupariation and eclosion behavior in the flesh fly, Sarcophaga bullata Parker (Diptera: Sarcophagidae), by venom from the ectoparasitic wasp Nasonia vitripennis (Walker) (Hymenoptera: Pteromalidae)

✍ David B. Rivers; Jan Zdarek; David L. Denlinger 📂 Article 📅 2004 🏛 John Wiley and Sons 🌐 English ⚖ 265 KB

## Abstract The action of venom from the ectoparasitic wasp, __Nasonia vitripennis__, was monitored by examining alterations in patterned muscular movements characteristic of pupariation and eclosion behavior in the flesh fly, __Sarcophaga bullata__. Venom injected into larvae prior to pupariation